UBE3B anticorps (Middle Region)

N° du produit ABIN631147

Détail du produit anti-UBE3B anticorps

Antigène: UBE3B (Ubiquitin Protein Ligase E3B (UBE3B))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE3B est non-conjugé

Application: Western Blotting (WB)

Specificité: UBE3 B antibody was raised against the middle region of UBE3

Purification: Affinity purified

Immunogène: UBE3 B antibody was raised using the middle region of UBE3 corresponding to a region with amino acids VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE3B Blocking Peptide, catalog no. 33R-9458, is also available for use as a blocking control in assays to test for specificity of this UBE3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE3B

Antigène: UBE3B (Ubiquitin Protein Ligase E3B (UBE3B))

Autre désignation: UBE3B (UBE3B Produits)

Synonymes: anticorps si:dkey-189p24.3, anticorps BPIDS, anticorps AI449831, anticorps AU020130, anticorps ubiquitin protein ligase E3B, anticorps ubiquitin-protein ligase E3B, anticorps ubiquitin protein ligase E3B L homeolog, anticorps UBE3B, anticorps ube3b, anticorps LOC581811, anticorps ube3b.L, anticorps Ube3b

Sujet: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE3B is a member of the E3 ubiquitin-conjugating enzyme family. UBE3B may interact with other proteins and play a role in stress response.

Poids moléculaire: 123 kDa (MW of target protein)