PNPO anticorps (N-Term)

N° du produit ABIN631149

Détail du produit anti-PNPO anticorps

Antigène: PNPO (Pyridoxamine 5'-Phosphate Oxidase (PNPO))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNPO est non-conjugé

Application: Western Blotting (WB)

Specificité: PNPO antibody was raised against the N terminal of PNPO

Purification: Affinity purified

Immunogène: PNPO antibody was raised using the N terminal of PNPO corresponding to a region with amino acids PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNPO Blocking Peptide, catalog no. 33R-7225, is also available for use as a blocking control in assays to test for specificity of this PNPO antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNPO

Antigène: PNPO (Pyridoxamine 5'-Phosphate Oxidase (PNPO))

Autre désignation: PNPO (PNPO Produits)

Synonymes: anticorps im:7138360, anticorps ECK1634, anticorps JW1630, anticorps PDXPO, anticorps AI415282, anticorps pyridoxamine 5'-phosphate oxidase, anticorps pyridoxine 5'-phosphate oxidase, anticorps Pyridoxamine 5'-phosphate oxidase, anticorps pnpo, anticorps pdxH, anticorps Mrub_2888, anticorps Arnit_1624, anticorps Ndas_4168, anticorps Mesil_2817, anticorps Isop_0296, anticorps Despr_1960, anticorps Pedsa_1348, anticorps Mesop_5639, anticorps PNPO, anticorps Pnpo

Sujet: PNPO catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.

Poids moléculaire: 29 kDa (MW of target protein)