PCDH17 anticorps (C-Term)

N° du produit ABIN631153

Détail du produit anti-PCDH17 anticorps

Antigène: PCDH17 (Protocadherin 17 (PCDH17))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDH17 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDH17 antibody was raised against the C terminal of PCDH17

Purification: Affinity purified

Immunogène: PCDH17 antibody was raised using the C terminal of PCDH17 corresponding to a region with amino acids SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDH17 Blocking Peptide, catalog no. 33R-8394, is also available for use as a blocking control in assays to test for specificity of this PCDH17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDH17

Antigène: PCDH17 (Protocadherin 17 (PCDH17))

Autre désignation: PCDH17 (PCDH17 Produits)

Synonymes: anticorps PCDH68, anticorps PCH68, anticorps C030033F14Rik, anticorps Gm78, anticorps protocadherin 17, anticorps PCDH17, anticorps Pcdh17

Sujet: PCDH17 contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins.It may play a role in the establishment and function of specific cell-cell connections in the brain.

Poids moléculaire: 124 kDa (MW of target protein)