MTPN anticorps (Middle Region)
-
- Antigène Voir toutes MTPN Anticorps
- MTPN (Myotrophin (MTPN))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MTPN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Myotrophin antibody was raised against the middle region of MTPN
- Purification
- Affinity purified
- Immunogène
- Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV
- Top Product
- Discover our top product MTPN Anticorps primaire
-
anti-Myotrophin (MTPN) (AA 1-118) antibody
MTPN Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 1F3 unconjugated
anti-Myotrophin (MTPN) (AA 1-118) antibodyMTPN Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-Myotrophin (MTPN) (AA 35-84) antibodyMTPN Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Lapin, Cobaye, Poisson zèbre (Danio rerio), Cheval, Singe, Roussette (Chauve-souris), Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Myotrophin (MTPN) (AA 2-118) antibodyMTPN Reactivité: Souris WB, IHC, ICC Hôte: Lapin Polyclonal unconjugated
anti-Myotrophin (MTPN) (Middle Region) antibodyMTPN Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Lapin, Cobaye, Poisson zèbre (Danio rerio), Cheval WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Myotrophin Blocking Peptide, catalog no. 33R-3534, is also available for use as a blocking control in assays to test for specificity of this Myotrophin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTPN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MTPN (Myotrophin (MTPN))
- Autre désignation
- Myotrophin (MTPN Produits)
- Synonymes
- anticorps MGC76285, anticorps GCDP, anticorps V-1, anticorps Gcdp, anticorps wu:fa10f07, anticorps zgc:64078, anticorps 5033418D15Rik, anticorps V1, anticorps myotrophin, anticorps myotrophin S homeolog, anticorps mtpn, anticorps MTPN, anticorps Mtpn, anticorps mtpn.S
- Sujet
- MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.
- Poids moléculaire
- 13 kDa (MW of target protein)
-
