TUSC1 anticorps (Middle Region)

N° du produit ABIN631164

Détail du produit anti-TUSC1 anticorps

Antigène: TUSC1 (Tumor Suppressor Candidate 1 (TUSC1))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUSC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TUSC1 antibody was raised against the middle region of TUSC1

Purification: Affinity purified

Immunogène: TUSC1 antibody was raised using the middle region of TUSC1 corresponding to a region with amino acids DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TUSC1 Blocking Peptide, catalog no. 33R-2164, is also available for use as a blocking control in assays to test for specificity of this TUSC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUSC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUSC1

Antigène: TUSC1 (Tumor Suppressor Candidate 1 (TUSC1))

Autre désignation: TUSC1 (TUSC1 Produits)

Synonymes: anticorps TSG-9, anticorps TSG9, anticorps 2200001D17Rik, anticorps tumor suppressor candidate 1, anticorps TUSC1, anticorps Tusc1

Sujet: Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.

Poids moléculaire: 23 kDa (MW of target protein)