GCHFR anticorps (N-Term)

N° du produit ABIN631166

Détail du produit anti-GCHFR anticorps

Antigène: GCHFR (GTP Cyclohydrolase I Feedback Regulator (GCHFR))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GCHFR est non-conjugé

Application: Western Blotting (WB)

Specificité: GCHFR antibody was raised against the N terminal of GCHFR

Purification: Affinity purified

Immunogène: GCHFR antibody was raised using the N terminal of GCHFR corresponding to a region with amino acids MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GCHFR Blocking Peptide, catalog no. 33R-6313, is also available for use as a blocking control in assays to test for specificity of this GCHFR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCHFR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GCHFR

Antigène: GCHFR (GTP Cyclohydrolase I Feedback Regulator (GCHFR))

Autre désignation: GCHFR (GCHFR Produits)

Synonymes: anticorps GFRP, anticorps HsT16933, anticorps P35, anticorps 2010323F13Rik, anticorps GTP cyclohydrolase I feedback regulator, anticorps GCHFR, anticorps Gchfr

Sujet: GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.

Poids moléculaire: 10 kDa (MW of target protein)