SULT6B1 anticorps (C-Term)
-
- Antigène Voir toutes SULT6B1 Anticorps
- SULT6B1 (Sulfotransferase Family, Cytosolic, 6B, Member 1 (SULT6B1))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SULT6B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SULT6 B1 antibody was raised against the C terminal of SULT6 1
- Purification
- Affinity purified
- Immunogène
- SULT6 B1 antibody was raised using the C terminal of SULT6 1 corresponding to a region with amino acids FLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNL
- Top Product
- Discover our top product SULT6B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SULT6B1 Blocking Peptide, catalog no. 33R-2961, is also available for use as a blocking control in assays to test for specificity of this SULT6B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SULT6B1 (Sulfotransferase Family, Cytosolic, 6B, Member 1 (SULT6B1))
- Autre désignation
- SULT6B1 (SULT6B1 Produits)
- Synonymes
- anticorps 2410078J06Rik, anticorps AV101767, anticorps ST6B1, anticorps sulfotransferase family 6B member 1, anticorps sulfotransferase family, cytosolic, 6B, member 1, anticorps SULT6B1, anticorps Sult6b1
- Sujet
- SULT6B1 belongs to the sulfotransferase 1 family. SULT6B1 may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters.
- Poids moléculaire
- 30 kDa (MW of target protein)
-