SULT6B1 anticorps (C-Term)

N° du produit ABIN631168

Détail du produit anti-SULT6B1 anticorps

Antigène: SULT6B1 (Sulfotransferase Family, Cytosolic, 6B, Member 1 (SULT6B1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SULT6B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SULT6 B1 antibody was raised against the C terminal of SULT6 1

Purification: Affinity purified

Immunogène: SULT6 B1 antibody was raised using the C terminal of SULT6 1 corresponding to a region with amino acids FLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SULT6B1 Blocking Peptide, catalog no. 33R-2961, is also available for use as a blocking control in assays to test for specificity of this SULT6B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SULT6B1

Antigène: SULT6B1 (Sulfotransferase Family, Cytosolic, 6B, Member 1 (SULT6B1))

Autre désignation: SULT6B1 (SULT6B1 Produits)

Synonymes: anticorps 2410078J06Rik, anticorps AV101767, anticorps ST6B1, anticorps sulfotransferase family 6B member 1, anticorps sulfotransferase family, cytosolic, 6B, member 1, anticorps SULT6B1, anticorps Sult6b1

Sujet: SULT6B1 belongs to the sulfotransferase 1 family. SULT6B1 may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters.

Poids moléculaire: 30 kDa (MW of target protein)