ALDOC anticorps (C-Term)

N° du produit ABIN631176

Détail du produit anti-ALDOC anticorps

Antigène: ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDOC est non-conjugé

Application: Western Blotting (WB)

Specificité: ALDOC antibody was raised against the C terminal of ALDOC

Purification: Affinity purified

Immunogène: ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDOC Blocking Peptide, catalog no. 33R-1767, is also available for use as a blocking control in assays to test for specificity of this ALDOC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDOC

Antigène: ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))

Autre désignation: ALDOC (ALDOC Produits)

Synonymes: anticorps ALDC, anticorps MGC69434, anticorps ALDOC, anticorps aldoc, anticorps AI847350, anticorps AU040929, anticorps Aldo3, anticorps Scrg2, anticorps ALDCAA, anticorps F16dip7, anticorps RATALDCAA, anticorps aldocl, anticorps wu:fj56h04, anticorps zgc:112357, anticorps QccE-21970, anticorps aldolase, fructose-bisphosphate C, anticorps aldolase, fructose-bisphosphate C L homeolog, anticorps aldolase C, fructose-bisphosphate, b, anticorps aldolase C, fructose-bisphosphate, anticorps aldolase A, fructose-bisphosphate, anticorps aldolase C, fructose-bisphosphate, a, anticorps Fructose-bisphosphate aldolase C, anticorps ALDOC, anticorps aldoc.L, anticorps aldoc, anticorps aldocb, anticorps Aldoc, anticorps ALDOA, anticorps aldoca

Sujet: ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.

Poids moléculaire: 39 kDa (MW of target protein)