SULT2B1 anticorps (C-Term)

N° du produit ABIN631179

Détail du produit anti-SULT2B1 anticorps

Antigène: SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SULT2B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SULT2 B1 antibody was raised against the C terminal of SULT2 1

Purification: Affinity purified

Immunogène: SULT2 B1 antibody was raised using the C terminal of SULT2 1 corresponding to a region with amino acids NTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SULT2B1 Blocking Peptide, catalog no. 33R-6902, is also available for use as a blocking control in assays to test for specificity of this SULT2B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SULT2B1

Antigène: SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))

Autre désignation: SULT2B1 (SULT2B1 Produits)

Synonymes: anticorps HSST2, anticorps AI326997, anticorps BB173635, anticorps ST2B1, anticorps SULT2B, anticorps SULT2B1, anticorps MGC79784, anticorps sulfotransferase family 2B member 1, anticorps sulfotransferase family, cytosolic, 2B, member 1, anticorps sulfotransferase family 2B member 1 L homeolog, anticorps SULT2B1, anticorps Sult2b1, anticorps sult2b1, anticorps sult2b1.L

Sujet: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis