Peripherin anticorps (N-Term)
-
- Antigène Voir toutes Peripherin (PRPH) Anticorps
- Peripherin (PRPH)
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Peripherin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRPH antibody was raised against the N terminal of PRPH
- Purification
- Affinity purified
- Immunogène
- PRPH antibody was raised using the N terminal of PRPH corresponding to a region with amino acids RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE
- Top Product
- Discover our top product PRPH Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRPH Blocking Peptide, catalog no. 33R-7897, is also available for use as a blocking control in assays to test for specificity of this PRPH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Peripherin (PRPH)
- Autre désignation
- PRPH (PRPH Produits)
- Synonymes
- anticorps NEF4, anticorps PRPH1, anticorps Prph1, anticorps Perf, anticorps nef4, anticorps prph1, anticorps MGC69454, anticorps if3, anticorps plasticin, anticorps zgc:111926, anticorps peripherin, anticorps peripherin L homeolog, anticorps PRPH, anticorps Prph, anticorps prph, anticorps prph.L
- Sujet
- This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin.
- Poids moléculaire
- 54 kDa (MW of target protein)
-