SULT1A1 anticorps (N-Term)
-
- Antigène Voir toutes SULT1A1 Anticorps
- SULT1A1 (Sulfotransferase Family, Cytosolic, 1A, Phenol-Preferring, Member 1 (SULT1A1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SULT1A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SULT1 A1 antibody was raised against the N terminal of SULT1 1
- Purification
- Affinity purified
- Immunogène
- SULT1 A1 antibody was raised using the N terminal of SULT1 1 corresponding to a region with amino acids ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT
- Top Product
- Discover our top product SULT1A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SULT1A1 Blocking Peptide, catalog no. 33R-2553, is also available for use as a blocking control in assays to test for specificity of this SULT1A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SULT1A1 (Sulfotransferase Family, Cytosolic, 1A, Phenol-Preferring, Member 1 (SULT1A1))
- Autre désignation
- SULT1A1 (SULT1A1 Produits)
- Synonymes
- anticorps HAST1/HAST2, anticorps P-PST, anticorps PST, anticorps ST1A1, anticorps ST1A3, anticorps STP, anticorps STP1, anticorps TSPST1, anticorps AI266890, anticorps Stp, anticorps Stp1, anticorps ASTIV, anticorps Mx-ST, anticorps PST-1, anticorps St1a1, anticorps Stm, anticorps Sult1a3, anticorps pst, anticorps st1a3, anticorps stp, anticorps stp1, anticorps tspst1, anticorps cSULT1A1, anticorps SULT1A2, anticorps SULT1A1, anticorps SIAT8-D, anticorps ST8SiaIV, anticorps Siat8d, anticorps PST1, anticorps SIAT8D, anticorps ST8SIA-IV, anticorps sulfotransferase family 1A member 1, anticorps sulfotransferase family 1A, phenol-preferring, member 1, anticorps sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1, anticorps sulfotransferase family 1A member 1 S homeolog, anticorps sulfotransferase 1A1, anticorps ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4, anticorps SULT1A1, anticorps Sult1a1, anticorps sult1a1, anticorps sult1a1.S, anticorps LOC704658, anticorps LOC709318, anticorps St8sia4, anticorps ST8SIA4, anticorps LOC100064221
- Sujet
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity.
- Poids moléculaire
- 34 kDa (MW of target protein)
-