TINF2 anticorps

N° du produit ABIN631193

Détail du produit anti-TINF2 anticorps

Antigène: TINF2 (TIN2) (TERF1 Interacting Nuclear Factor 2 (TIN2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TINF2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TINF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TINF2 Blocking Peptide, catalog no. 33R-8348, is also available for use as a blocking control in assays to test for specificity of this TINF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TINF2

Antigène: TINF2 (TIN2) (TERF1 Interacting Nuclear Factor 2 (TIN2))

Autre désignation: TINF2 (TIN2 Produits)

Synonymes: anticorps DKCA3, anticorps TIN2, anticorps AW552114, anticorps D14Wsu146e, anticorps Tin2, anticorps TERF1 interacting nuclear factor 2, anticorps Terf1 (TRF1)-interacting nuclear factor 2, anticorps TINF2, anticorps Tinf2

Sujet: TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends, without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Cycle Cellulaire, Telomere Maintenance, Regulation of Carbohydrate Metabolic Process