Rhotekin anticorps (N-Term)

N° du produit ABIN631197

Détail du produit anti-Rhotekin anticorps

Antigène: Rhotekin (RTKN)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Rhotekin est non-conjugé

Application: Western Blotting (WB)

Specificité: Rhotekin antibody was raised against the N terminal of RTKN

Purification: Affinity purified

Immunogène: Rhotekin antibody was raised using the N terminal of RTKN corresponding to a region with amino acids DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Rhotekin Blocking Peptide, catalog no. 33R-2163, is also available for use as a blocking control in assays to test for specificity of this Rhotekin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTKN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Rhotekin

Antigène: Rhotekin (RTKN)

Autre désignation: Rhotekin (RTKN Produits)

Synonymes: anticorps RTKN, anticorps rhotekin, anticorps RTKN, anticorps rtkn, anticorps Rtkn

Sujet: RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.

Poids moléculaire: 63 kDa (MW of target protein)