WDR6 anticorps (C-Term)
-
- Antigène Voir toutes WDR6 Anticorps
- WDR6 (WD Repeat Domain 6 (WDR6))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WDR6 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- WDR6 antibody was raised against the C terminal of WDR6
- Purification
- Affinity purified
- Immunogène
- WDR6 antibody was raised using the C terminal of WDR6 corresponding to a region with amino acids TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE
- Top Product
- Discover our top product WDR6 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WDR6 Blocking Peptide, catalog no. 33R-9232, is also available for use as a blocking control in assays to test for specificity of this WDR6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WDR6 (WD Repeat Domain 6 (WDR6))
- Autre désignation
- WDR6 (WDR6 Produits)
- Synonymes
- anticorps WDR6, anticorps mWDR6, anticorps WD repeat domain 6, anticorps WDR6, anticorps Wdr6
- Sujet
- WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
- Poids moléculaire
- 53 kDa (MW of target protein)
-