DSTYK anticorps (Middle Region)
-
- Antigène Voir toutes DSTYK Anticorps
- DSTYK (Dual serine/threonine and tyrosine Protein Kinase (DSTYK))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DSTYK est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RIPK5 antibody was raised against the middle region of RIPK5
- Purification
- Affinity purified
- Immunogène
- RIPK5 antibody was raised using the middle region of RIPK5 corresponding to a region with amino acids EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS
- Top Product
- Discover our top product DSTYK Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RIPK5 Blocking Peptide, catalog no. 33R-2341, is also available for use as a blocking control in assays to test for specificity of this RIPK5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIPK5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DSTYK (Dual serine/threonine and tyrosine Protein Kinase (DSTYK))
- Autre désignation
- RIPK5 (DSTYK Produits)
- Synonymes
- anticorps CAKUT1, anticorps DustyPK, anticorps RIP5, anticorps RIPK5, anticorps A930019K20Rik, anticorps C430014H23Rik, anticorps C820013G01, anticorps Ripk5, anticorps ripk5, anticorps zgc:136421, anticorps DSTYK, anticorps GB11994, anticorps DUSTYPK, anticorps dual serine/threonine and tyrosine protein kinase, anticorps receptor interacting protein kinase 5, anticorps dual serine/threonine and tyrosine protein kinase S homeolog, anticorps DSTYK, anticorps Dstyk, anticorps dstyk, anticorps Ripk5, anticorps dstyk.S
- Sujet
- RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.
- Poids moléculaire
- 100 kDa (MW of target protein)
-