PRAME anticorps (N-Term)

N° du produit ABIN631203

Détail du produit anti-PRAME anticorps

Antigène: PRAME (Preferentially Expressed Antigen in Melanoma (PRAME))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRAME est non-conjugé

Application: Western Blotting (WB)

Specificité: PRAME antibody was raised against the N terminal of PRAME

Purification: Affinity purified

Immunogène: PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRAME Blocking Peptide, catalog no. 33R-5955, is also available for use as a blocking control in assays to test for specificity of this PRAME antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRAME antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRAME

Antigène: PRAME (Preferentially Expressed Antigen in Melanoma (PRAME))

Autre désignation: PRAME (PRAME Produits)

Synonymes: anticorps PRAME, anticorps CT130, anticorps MAPE, anticorps OIP-4, anticorps OIP4, anticorps 4930534P07Rik, anticorps preferentially expressed antigen in melanoma, anticorps PRAME, anticorps Prame

Sujet: PRAME functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. PRAME prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Nuclear Hormone Receptor Binding