-
- Antigène Voir toutes UBR1 Anticorps
- UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UBR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UBR1 antibody was raised against the N terminal of UBR1
- Purification
- Affinity purified
- Immunogène
- UBR1 antibody was raised using the N terminal of UBR1 corresponding to a region with amino acids YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL
- Top Product
- Discover our top product UBR1 Anticorps primaire
-
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 2-100) antibody
UBR1 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 2F5 unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 722-862) antibodyUBR1 Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 245-274), (N-Term) antibodyUBR1 Reactivité: Souris WB Hôte: Lapin Polyclonal RB41861 unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 2-100) antibodyUBR1 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 2-100) antibodyUBR1 Reactivité: Humain ELISA, IF Hôte: Souris Monoclonal 4G7 unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 801-900) antibodyUBR1 Reactivité: Humain, Souris WB, ELISA, IF (cc), IF (p), IHC (fro), IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (Internal Region) antibodyUBR1 Reactivité: Humain, Souris WB, ELISA, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 396-445) antibodyUBR1 Reactivité: Humain, Chien, Lapin, Singe, Cobaye, Roussette (Chauve-souris) WB Hôte: Lapin Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (N-Term) antibodyUBR1 Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cheval, Lapin, Cobaye, Saccharomyces cerevisiae WB Hôte: Lapin Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (Internal Region) antibodyUBR1 Reactivité: Humain, Souris WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UBR1 Blocking Peptide, catalog no. 33R-10155, is also available for use as a blocking control in assays to test for specificity of this UBR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))
- Autre désignation
- UBR1 (UBR1 Produits)
- Synonymes
- anticorps Dmel\\CG9086, anticorps Ubr1, anticorps UBR1, anticorps JBS, anticorps AI504731, anticorps RGD1562326, anticorps Ubr1 ubiquitin ligase, anticorps ubiquitin protein ligase E3 component n-recognin 1, anticorps E3 ubiquitin-protein ligase ubr-1, anticorps Ubr1, anticorps ubr1, anticorps UBR1, anticorps ubr-1
- Sujet
- UBR1 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. recognises and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
- Poids moléculaire
- 200 kDa (MW of target protein)
-
Vous êtes ici:
