AASDHPPT anticorps (C-Term)

N° du produit ABIN631211

Détail du produit anti-AASDHPPT anticorps

Antigène: AASDHPPT (Aminoadipate-Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase (AASDHPPT))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AASDHPPT est non-conjugé

Application: Western Blotting (WB)

Specificité: AASDHPPT antibody was raised against the C terminal of AASDHPPT

Purification: Affinity purified

Immunogène: AASDHPPT antibody was raised using the C terminal of AASDHPPT corresponding to a region with amino acids SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AASDHPPT Blocking Peptide, catalog no. 33R-8756, is also available for use as a blocking control in assays to test for specificity of this AASDHPPT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AASDHPPT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AASDHPPT

Antigène: AASDHPPT (Aminoadipate-Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase (AASDHPPT))

Autre désignation: AASDHPPT (AASDHPPT Produits)

Synonymes: anticorps AASD-PPT, anticorps LYS2, anticorps LYS5, anticorps 2010309J24Rik, anticorps 2810407B07Rik, anticorps CGI-80, anticorps AASDHPPT, anticorps DDBDRAFT_0186752, anticorps DDBDRAFT_0304576, anticorps DDB_0186752, anticorps DDB_0304576, anticorps aasdhppt, anticorps aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, anticorps aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase S homeolog, anticorps AASDHPPT, anticorps Aasdhppt, anticorps Bm1_31065, anticorps DDB_G0285927, anticorps aasdhppt, anticorps aasdhppt.S

Sujet: AASDHPPT is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.

Poids moléculaire: 36 kDa (MW of target protein)