COTL1 anticorps
-
- Antigène Voir toutes COTL1 Anticorps
- COTL1 (Coactosin-Like Protein)
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp COTL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Coactosin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ
- Top Product
- Discover our top product COTL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Coactosin-Like 1 Blocking Peptide, catalog no. 33R-5779, is also available for use as a blocking control in assays to test for specificity of this Coactosin-Like 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COTL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- COTL1 (Coactosin-Like Protein)
- Autre désignation
- Coactosin-Like 1 (COTL1 Produits)
- Synonymes
- anticorps CLP, anticorps 1810074P22Rik, anticorps 2010004C08Rik, anticorps Clp, anticorps coactosin like F-actin binding protein 1, anticorps coactosin-like 1 (Dictyostelium), anticorps coactosin-like F-actin binding protein 1, anticorps COTL1, anticorps Cotl1
- Sujet
- This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis.
- Poids moléculaire
- 16 kDa (MW of target protein)
-