GALT anticorps (C-Term)

N° du produit ABIN631216

Détail du produit anti-GALT anticorps

Antigène: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALT est non-conjugé

Application: Western Blotting (WB)

Specificité: GALT antibody was raised against the C terminal of GALT

Purification: Affinity purified

Immunogène: GALT antibody was raised using the C terminal of GALT corresponding to a region with amino acids LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALT Blocking Peptide, catalog no. 33R-5189, is also available for use as a blocking control in assays to test for specificity of this GALT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GALT

Antigène: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Autre désignation: GALT (GALT Produits)

Synonymes: anticorps GALT, anticorps AW553376, anticorps CG9232, anticorps Dmel\\CG9232, anticorps dGALT, anticorps galactose-1-phosphate uridylyltransferase, anticorps galactose-1-phosphate uridylyltransferase, GalT, anticorps probable galactose-1-phosphate uridylyltransferase galtb [second part], anticorps UDP-glucose--galactose-1-phosphate uridylyltransferase, anticorps GalT galactose-1-phosphate uridylyltransferase, anticorps galactose-1-phosphate uridyl transferase, anticorps Galactose-1-phosphate uridylyltransferase, anticorps galactose-1-phosphate uridylyltransferase S homeolog, anticorps GALT, anticorps galT, anticorps Galt, anticorps CNM00620, anticorps Mrub_2813, anticorps Mesil_2395, anticorps Trad_0989, anticorps Igag_1846, anticorps VDIS_RS10425, anticorps Intca_2810, anticorps Marky_2157, anticorps Selsp_1876, anticorps Trebr_2368, anticorps Halhy_5538, anticorps Theth_1357, anticorps galt.S

Sujet: Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet.

Poids moléculaire: 43 kDa (MW of target protein)