GALT anticorps (C-Term)
-
- Antigène Voir toutes GALT Anticorps
- GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GALT est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GALT antibody was raised against the C terminal of GALT
- Purification
- Affinity purified
- Immunogène
- GALT antibody was raised using the C terminal of GALT corresponding to a region with amino acids LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET
- Top Product
- Discover our top product GALT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GALT Blocking Peptide, catalog no. 33R-5189, is also available for use as a blocking control in assays to test for specificity of this GALT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))
- Autre désignation
- GALT (GALT Produits)
- Synonymes
- anticorps GALT, anticorps AW553376, anticorps CG9232, anticorps Dmel\\CG9232, anticorps dGALT, anticorps galactose-1-phosphate uridylyltransferase, anticorps galactose-1-phosphate uridylyltransferase, GalT, anticorps probable galactose-1-phosphate uridylyltransferase galtb [second part], anticorps UDP-glucose--galactose-1-phosphate uridylyltransferase, anticorps GalT galactose-1-phosphate uridylyltransferase, anticorps galactose-1-phosphate uridyl transferase, anticorps Galactose-1-phosphate uridylyltransferase, anticorps galactose-1-phosphate uridylyltransferase S homeolog, anticorps GALT, anticorps galT, anticorps Galt, anticorps CNM00620, anticorps Mrub_2813, anticorps Mesil_2395, anticorps Trad_0989, anticorps Igag_1846, anticorps VDIS_RS10425, anticorps Intca_2810, anticorps Marky_2157, anticorps Selsp_1876, anticorps Trebr_2368, anticorps Halhy_5538, anticorps Theth_1357, anticorps galt.S
- Sujet
- Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet.
- Poids moléculaire
- 43 kDa (MW of target protein)
-