Ketohexokinase anticorps
-
- Antigène Voir toutes Ketohexokinase (KHK) Anticorps
- Ketohexokinase (KHK)
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Ketohexokinase est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV
- Top Product
- Discover our top product KHK Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KHK Blocking Peptide, catalog no. 33R-3036, is also available for use as a blocking control in assays to test for specificity of this KHK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Ketohexokinase (KHK)
- Autre désignation
- KHK (KHK Produits)
- Synonymes
- anticorps wu:fj68h03, anticorps zgc:92219, anticorps zgc:92626, anticorps KHK, anticorps khk, anticorps KETHPRO, anticorps ketohexokinase, anticorps Ketohexokinase, anticorps KHK, anticorps khk, anticorps Hhal_0921, anticorps AaeL_AAEL006316, anticorps Nwat_0240, anticorps Khk
- Sujet
- KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.KHK encodes the gene ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The splice variant presented encodes the highly active form found in liver, renal cortex, and small intestine, while the alternate variant encodes the lower activity form found in most other tissues.
- Poids moléculaire
- 33 kDa (MW of target protein)
-