Ubiquilin 3 anticorps (N-Term)
-
- Antigène Voir toutes Ubiquilin 3 (UBQLN3) Anticorps
- Ubiquilin 3 (UBQLN3)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Ubiquilin 3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Ubiquilin 3 antibody was raised against the N terminal of UBQLN3
- Purification
- Affinity purified
- Immunogène
- Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE
- Top Product
- Discover our top product UBQLN3 Anticorps primaire
-
anti-Ubiquilin 3 (UBQLN3) (Internal Region) antibody
UBQLN3 Reactivité: Humain, Souris, Rat WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Ubiquilin 3 (UBQLN3) (AA 306-620) antibodyUBQLN3 Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Ubiquilin 3 (UBQLN3) (AA 1-30), (N-Term) antibodyUBQLN3 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB4563-4564 unconjugated
anti-Ubiquilin 3 (UBQLN3) (AA 547-576), (C-Term) antibodyUBQLN3 Reactivité: Humain, Souris WB Hôte: Lapin Polyclonal RB4569 unconjugated
anti-Ubiquilin 3 (UBQLN3) (AA 157-206) antibodyUBQLN3 Reactivité: Humain, Souris, Boeuf (Vache), Singe, Cheval, Porc, Lapin, Roussette (Chauve-souris), Hamster WB Hôte: Lapin Polyclonal unconjugated
anti-Ubiquilin 3 (UBQLN3) (N-Term) antibodyUBQLN3 Reactivité: Humain WB, IHC (p), EIA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Ubiquilin 3 Blocking Peptide, catalog no. 33R-5210, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Ubiquilin 3 (UBQLN3)
- Autre désignation
- Ubiquilin 3 (UBQLN3 Produits)
- Synonymes
- anticorps TUP-1, anticorps 4933400K24Rik, anticorps UBQLN3, anticorps ubiquilin 3, anticorps UBQLN3, anticorps Ubqln3
- Sujet
- UBQLN3 is an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.
- Poids moléculaire
- 72 kDa (MW of target protein)
-
