PIAS2 anticorps (N-Term)
-
- Antigène Voir toutes PIAS2 Anticorps
- PIAS2 (Protein Inhibitor of Activated STAT, 2 (PIAS2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PIAS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PIAS2 antibody was raised against the N terminal of PIAS2
- Purification
- Affinity purified
- Immunogène
- PIAS2 antibody was raised using the N terminal of PIAS2 corresponding to a region with amino acids RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST
- Top Product
- Discover our top product PIAS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIAS2 Blocking Peptide, catalog no. 33R-7881, is also available for use as a blocking control in assays to test for specificity of this PIAS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIAS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PIAS2 (Protein Inhibitor of Activated STAT, 2 (PIAS2))
- Autre désignation
- PIAS2 (PIAS2 Produits)
- Synonymes
- anticorps MGC83751, anticorps piasx, anticorps wu:fi05f09, anticorps PIAS2, anticorps 6330408K17Rik, anticorps AI462206, anticorps ARIP3, anticorps AU018068, anticorps Dib, anticorps Miz1, anticorps PIASxalpha, anticorps PIASxb, anticorps PIASxbeta, anticorps SIZ2, anticorps DIP, anticorps MIZ, anticorps MIZ1, anticorps PIASX, anticorps PIASX-ALPHA, anticorps PIASX-BETA, anticorps ZMIZ4, anticorps protein inhibitor of activated STAT 2 L homeolog, anticorps protein inhibitor of activated STAT 2, anticorps protein inhibitor of activated STAT, 2, anticorps pias2.L, anticorps PIAS2, anticorps pias2, anticorps Pias2
- Sujet
- Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway.
- Poids moléculaire
- 63 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
-