RAPSN anticorps (N-Term)
-
- Antigène Voir toutes RAPSN Anticorps
- RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAPSN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RAPSN antibody was raised against the N terminal of RAPSN
- Purification
- Affinity purified
- Immunogène
- RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLV
- Top Product
- Discover our top product RAPSN Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAPSN Blocking Peptide, catalog no. 33R-6061, is also available for use as a blocking control in assays to test for specificity of this RAPSN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPSN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))
- Autre désignation
- RAPSN (RAPSN Produits)
- Synonymes
- anticorps RAPSN, anticorps RAPSYN, anticorps RNF205, anticorps 43kDa, anticorps Nraps, anticorps Raps, anticorps rapsyn, anticorps receptor associated protein of the synapse, anticorps receptor associated protein of the synapse S homeolog, anticorps receptor-associated protein of the synapse, anticorps receptor-associated protein of the synapse, 43kD, anticorps RAPSN, anticorps rapsn.S, anticorps Rapsn, anticorps rapsn
- Sujet
- RAPSN belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin.
- Poids moléculaire
- 39 kDa (MW of target protein)
-