PKC zeta anticorps (N-Term)
-
- Antigène Voir toutes PKC zeta (PRKCZ) Anticorps
- PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PKC zeta est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRKCZ antibody was raised against the N terminal of PRKCZ
- Purification
- Affinity purified
- Immunogène
- PRKCZ antibody was raised using the N terminal of PRKCZ corresponding to a region with amino acids MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP
- Top Product
- Discover our top product PRKCZ Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRKCZ Blocking Peptide, catalog no. 33R-5876, is also available for use as a blocking control in assays to test for specificity of this PRKCZ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCZ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))
- Autre désignation
- PRKCZ (PRKCZ Produits)
- Synonymes
- anticorps TPKC, anticorps PKCzeta, anticorps prkcz-A, anticorps pkc-zeta, anticorps PRKCZ, anticorps pkc2, anticorps PKC-ZETA, anticorps PKC2, anticorps AI098070, anticorps C80388, anticorps Pkcz, anticorps R74924, anticorps aPKCzeta, anticorps zetaPKC, anticorps 14-3-3-zetaisoform, anticorps r14-3-3, anticorps pkcz, anticorps si:ch211-150o23.4, anticorps protein kinase C zeta L homeolog, anticorps protein kinase C zeta, anticorps protein kinase C, zeta, anticorps prkcz.L, anticorps PRKCZ, anticorps prkcz, anticorps Prkcz
- Sujet
- Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine.
- Poids moléculaire
- 45 kDa (MW of target protein)
- Pathways
- Signalisation NF-kappaB, Signalisation RTK, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling
-