TJP2 anticorps

N° du produit ABIN631228

Détail du produit anti-TJP2 anticorps

Antigène: TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TJP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TJP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TJP2 Blocking Peptide, catalog no. 33R-9376, is also available for use as a blocking control in assays to test for specificity of this TJP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TJP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TJP2

Antigène: TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))

Autre désignation: TJP2 (TJP2 Produits)

Synonymes: anticorps C9DUPq21.11, anticorps DFNA51, anticorps DUP9q21.11, anticorps X104, anticorps ZO2, anticorps ZO-2, anticorps zo2, anticorps tjp2, anticorps x104, anticorps zo-2, anticorps wu:fb62b09, anticorps zgc:92094, anticorps tight junction protein 2, anticorps tight junction protein 2 L homeolog, anticorps tight junction protein 2b (zona occludens 2), anticorps TJP2, anticorps Tjp2, anticorps tjp2.L, anticorps tjp2b

Sujet: Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. TJPs bind to the cytoplasmic C termini of junctional transmembrane proteins and link them to the actin cytoskeleton.

Poids moléculaire: 134 kDa (MW of target protein)