PHKG2 anticorps

N° du produit ABIN631242

Détail du produit anti-PHKG2 anticorps

Antigène: PHKG2 (phosphorylase Kinase, gamma 2 (Testis) (PHKG2))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PHKG2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: PHKG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PHKG2 Blocking Peptide, catalog no. 33R-2309, is also available for use as a blocking control in assays to test for specificity of this PHKG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHKG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PHKG2

Antigène: PHKG2 (phosphorylase Kinase, gamma 2 (Testis) (PHKG2))

Autre désignation: PHKG2 (PHKG2 Produits)

Synonymes: anticorps PHKG2, anticorps MGC145608, anticorps zgc:55863, anticorps GSD9C, anticorps 1500017I02Rik, anticorps phosphorylase kinase catalytic subunit gamma 2, anticorps phosphorylase kinase, gamma 2 (testis), anticorps phosphorylase kinase, gamma 2 (testis) L homeolog, anticorps PHKG2, anticorps phkg2, anticorps phkg2.L, anticorps Phkg2

Sujet: Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process