UMPS anticorps (C-Term)

N° du produit ABIN631243

Détail du produit anti-UMPS anticorps

Antigène: UMPS (Uridine Monophosphate Synthetase (UMPS))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UMPS est non-conjugé

Application: Western Blotting (WB)

Specificité: UMPS antibody was raised against the C terminal of UMPS

Purification: Affinity purified

Immunogène: UMPS antibody was raised using the C terminal of UMPS corresponding to a region with amino acids VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UMPS Blocking Peptide, catalog no. 33R-9552, is also available for use as a blocking control in assays to test for specificity of this UMPS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UMPS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UMPS

Antigène: UMPS (Uridine Monophosphate Synthetase (UMPS))

Autre désignation: UMPS (UMPS Produits)

Synonymes: anticorps zgc:55702, anticorps zgc:55723, anticorps UMPS, anticorps OPRT, anticorps 1700095D23Rik, anticorps AA408257, anticorps AL033308, anticorps BB164745, anticorps Orotidine 5'-phosphate decarboxylase, anticorps uridine monophosphate synthetase, anticorps uridine monophosphate synthetase L homeolog, anticorps uridine 5'-monophosphate synthase, anticorps umps-1, anticorps umps, anticorps umps.L, anticorps UMPS, anticorps LOC100556619, anticorps Umps

Sujet: OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process