MAK anticorps (C-Term)

N° du produit ABIN631245

Détail du produit anti-MAK anticorps

Antigène: MAK (Male Germ Cell-Associated Kinase (MAK))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAK est non-conjugé

Application: Western Blotting (WB)

Specificité: MAK antibody was raised against the C terminal of MAK

Purification: Affinity purified

Immunogène: MAK antibody was raised using the C terminal of MAK corresponding to a region with amino acids WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAK Blocking Peptide, catalog no. 33R-9987, is also available for use as a blocking control in assays to test for specificity of this MAK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAK

Antigène: MAK (Male Germ Cell-Associated Kinase (MAK))

Autre désignation: MAK (MAK Produits)

Synonymes: anticorps RP62, anticorps dJ417M14.2, anticorps A930010O05Rik, anticorps Ick, anticorps fj04c02, anticorps wu:fj04c02, anticorps zgc:56603, anticorps rp62, anticorps xmak, anticorps MGC82717, anticorps MGC146434, anticorps male germ cell associated kinase, anticorps male germ cell-associated kinase, anticorps male germ cell associated kinase L homeolog, anticorps MAK, anticorps Mak, anticorps mak, anticorps mak.L

Sujet: MAK is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.

Poids moléculaire: 70 kDa (MW of target protein)