ACP6 anticorps (N-Term)

N° du produit ABIN631247

Détail du produit anti-ACP6 anticorps

Antigène: ACP6 (Acid Phosphatase 6, Lysophosphatidic (ACP6))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACP6 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACP6 antibody was raised against the N terminal of ACP6

Purification: Affinity purified

Immunogène: ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACP6 Blocking Peptide, catalog no. 33R-2253, is also available for use as a blocking control in assays to test for specificity of this ACP6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACP6

Antigène: ACP6 (Acid Phosphatase 6, Lysophosphatidic (ACP6))

Autre désignation: ACP6 (ACP6 Produits)

Synonymes: anticorps ACP6, anticorps im:7147584, anticorps zgc:172268, anticorps MGC146066, anticorps ACPL1, anticorps LPAP, anticorps PACPL1, anticorps 5730559A09Rik, anticorps AU022842, anticorps mPACPL1, anticorps acid phosphatase 6, lysophosphatidic, anticorps acid phosphatase 6, lysophosphatidic S homeolog, anticorps ACP6, anticorps acp6, anticorps acp6.S, anticorps Acp6

Sujet: ACP6 could hydrolyze lysophosphatidic acid to monoacylglycerol. It was originally reported to be located in the mitochondrion, but the evidence seems to be weak and contradictory with the presence of a cleaved signal sequence.

Poids moléculaire: 49 kDa (MW of target protein)