-
- Antigène Voir toutes WASF3 Anticorps
- WASF3 (WAS Protein Family, Member 3 (WASF3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WASF3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WASF3 antibody was raised against the N terminal of WASF3
- Purification
- Affinity purified
- Immunogène
- WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK
- Top Product
- Discover our top product WASF3 Anticorps primaire
-
anti-WAS Protein Family, Member 3 (WASF3) (AA 368-502) antibody
WASF3 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (Internal Region) antibodyWASF3 Reactivité: Humain, Souris, Rat WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 1-499) antibodyWASF3 Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 1-499) antibodyWASF3 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 21-120) antibodyWASF3 Reactivité: Souris, Rat WB, ELISA, FACS, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 200-300) antibodyWASF3 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 96-145) antibodyWASF3 Reactivité: Humain, Souris, Chien, Cobaye, Cheval, Singe, Boeuf (Vache), Lapin, Poisson zèbre (Danio rerio), Roussette (Chauve-souris), Poulet, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 184-233) antibodyWASF3 Reactivité: Humain, Souris, Chien, Cobaye, Cheval, Singe, Lapin, Roussette (Chauve-souris), Poulet, Xenopus laevis WB Hôte: Lapin Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (AA 35-208) antibodyWASF3 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-WAS Protein Family, Member 3 (WASF3) (N-Term) antibodyWASF3 Reactivité: Humain, Souris, Rat, Chien, Cobaye, Cheval, Boeuf (Vache), Lapin, Poisson zèbre (Danio rerio) WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WASF3 Blocking Peptide, catalog no. 33R-6796, is also available for use as a blocking control in assays to test for specificity of this WASF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WASF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WASF3 (WAS Protein Family, Member 3 (WASF3))
- Autre désignation
- WASF3 (WASF3 Produits)
- Synonymes
- anticorps wu:fb74d08, anticorps wu:fi28e02, anticorps zgc:158236, anticorps Brush-1, anticorps SCAR3, anticorps WAVE3, anticorps Scar3, anticorps Wave3, anticorps WAS protein family, member 3b, anticorps WAS protein family member 3, anticorps WAS protein family, member 3, anticorps wasf3b, anticorps WASF3, anticorps Wasf3
- Sujet
- WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.
- Poids moléculaire
- 55 kDa (MW of target protein)
- Pathways
- Signalisation RTK
-
Vous êtes ici:
