TDO2 anticorps (N-Term)

N° du produit ABIN631259

Détail du produit anti-TDO2 anticorps

Antigène: TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TDO2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TDO2 antibody was raised against the N terminal of TDO2

Purification: Affinity purified

Immunogène: TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TDO2 Blocking Peptide, catalog no. 33R-4940, is also available for use as a blocking control in assays to test for specificity of this TDO2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TDO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TDO2

Antigène: TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))

Autre désignation: TDO2 (TDO2 Produits)

Synonymes: anticorps Tdo2, anticorps tdo2l, anticorps fi30d08, anticorps zgc:63488, anticorps wu:fi30d08, anticorps TDO2, anticorps fb62b10, anticorps tdo2, anticorps wu:fb62b10, anticorps zgc:103693, anticorps DDBDRAFT_0190495, anticorps DDBDRAFT_0231363, anticorps DDB_0190495, anticorps DDB_0231363, anticorps TDO, anticorps TO, anticorps TPH2, anticorps TRPO, anticorps AA407491, anticorps chky, anticorps Tdo, anticorps tryptophan 2,3-dioxygenase b, anticorps tryptophan 2,3-dioxygenase, anticorps tryptophan 2,3-dioxygenase a, anticorps tryptophan 2,3-dioxygenase L homeolog, anticorps tdo2b, anticorps tdo2, anticorps TDO2, anticorps MADE_02822, anticorps CtCNB1_3657, anticorps tdo2a, anticorps CNC04830, anticorps tdo, anticorps Mrub_2119, anticorps Deipr_2235, anticorps Acav_1166, anticorps Mesop_4278, anticorps Tdo2, anticorps tdo2.L

Sujet: Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.

Poids moléculaire: 48 kDa (MW of target protein)