TSKS anticorps (N-Term)

N° du produit ABIN631260

Détail du produit anti-TSKS anticorps

Antigène: TSKS (Testis-Specific serine Kinase Substrate (TSKS))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSKS est non-conjugé

Application: Western Blotting (WB)

Specificité: TSKS antibody was raised against the N terminal of TSKS

Purification: Affinity purified

Immunogène: TSKS antibody was raised using the N terminal of TSKS corresponding to a region with amino acids MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TSKS Blocking Peptide, catalog no. 33R-5767, is also available for use as a blocking control in assays to test for specificity of this TSKS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSKS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSKS

Antigène: TSKS (Testis-Specific serine Kinase Substrate (TSKS))

Autre désignation: TSKS (TSKS Produits)

Synonymes: anticorps TSKS, anticorps STK22S1, anticorps TSKS1, anticorps TSSKS, anticorps Stk22s1, anticorps Tssks1, anticorps testis specific serine kinase substrate, anticorps testis-specific serine kinase substrate, anticorps TSKS, anticorps Tsks

Sujet: TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of TSKS is highest in the testis and down-regulated in testicular cancer.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Toll-Like Receptors Cascades