TSKS anticorps (N-Term)
-
- Antigène Voir toutes TSKS Anticorps
- TSKS (Testis-Specific serine Kinase Substrate (TSKS))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TSKS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TSKS antibody was raised against the N terminal of TSKS
- Purification
- Affinity purified
- Immunogène
- TSKS antibody was raised using the N terminal of TSKS corresponding to a region with amino acids MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK
- Top Product
- Discover our top product TSKS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TSKS Blocking Peptide, catalog no. 33R-5767, is also available for use as a blocking control in assays to test for specificity of this TSKS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSKS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TSKS (Testis-Specific serine Kinase Substrate (TSKS))
- Autre désignation
- TSKS (TSKS Produits)
- Sujet
- TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of TSKS is highest in the testis and down-regulated in testicular cancer.
- Poids moléculaire
- 65 kDa (MW of target protein)
- Pathways
- Toll-Like Receptors Cascades
-