NUDCD1 anticorps (N-Term)

N° du produit ABIN631265

Détail du produit anti-NUDCD1 anticorps

Antigène: NUDCD1 (NudC Domain Containing 1 (NUDCD1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUDCD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NUDCD1 antibody was raised against the N terminal of NUDCD1

Purification: Affinity purified

Immunogène: NUDCD1 antibody was raised using the N terminal of NUDCD1 corresponding to a region with amino acids EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUDCD1 Blocking Peptide, catalog no. 33R-2773, is also available for use as a blocking control in assays to test for specificity of this NUDCD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUDCD1

Antigène: NUDCD1 (NudC Domain Containing 1 (NUDCD1))

Autre désignation: NUDCD1 (NUDCD1 Produits)

Synonymes: anticorps Cml66, anticorps NUDCD1, anticorps CML66, anticorps OVA66, anticorps 4921532K09Rik, anticorps AA407246, anticorps AW260430, anticorps AW556235, anticorps CML66-L, anticorps RGD1310624, anticorps im:6901299, anticorps im:6912119, anticorps wu:fc11c02, anticorps zgc:110705, anticorps cml66, anticorps NudC domain containing 1, anticorps NudC domain-containing protein 1, anticorps NudC domain containing 1 S homeolog, anticorps NUDCD1, anticorps nudcd1, anticorps CpipJ_CPIJ019282, anticorps nudc1, anticorps LOC777229, anticorps Nudcd1, anticorps nudcd1.S

Sujet: NUDCD1 (CML66) contains 1 CS domain. It may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.

Poids moléculaire: 67 kDa (MW of target protein)