RHPN1 anticorps (Middle Region)

N° du produit ABIN631270

Détail du produit anti-RHPN1 anticorps

Antigène: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHPN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RHPN1 antibody was raised against the middle region of RHPN1

Purification: Affinity purified

Immunogène: RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHPN1 Blocking Peptide, catalog no. 33R-8917, is also available for use as a blocking control in assays to test for specificity of this RHPN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHPN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHPN1

Antigène: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Autre désignation: RHPN1 (RHPN1 Produits)

Synonymes: anticorps si:ch1073-260o7.1, anticorps ODF5, anticorps RHOPHILIN, anticorps RHPN, anticorps BB023497, anticorps Grbp, anticorps Rhophilin, anticorps mKIAA1929, anticorps rhophilin, Rho GTPase binding protein 1, anticorps rhophilin Rho GTPase binding protein 1, anticorps rhpn1, anticorps RHPN1, anticorps Rhpn1

Sujet: RHPN1 has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.

Poids moléculaire: 73 kDa (MW of target protein)