PANK4 anticorps (N-Term)

N° du produit ABIN631283

Détail du produit anti-PANK4 anticorps

Antigène: PANK4 (Pantothenate Kinase 4 (PANK4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PANK4 est non-conjugé

Application: Western Blotting (WB)

Specificité: PANK4 antibody was raised against the N terminal of PANK4

Purification: Affinity purified

Immunogène: PANK4 antibody was raised using the N terminal of PANK4 corresponding to a region with amino acids MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PANK4 Blocking Peptide, catalog no. 33R-5630, is also available for use as a blocking control in assays to test for specificity of this PANK4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PANK4

Antigène: PANK4 (Pantothenate Kinase 4 (PANK4))

Autre désignation: PANK4 (PANK4 Produits)

Sujet: This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells.

Poids moléculaire: 86 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process