Selenoprotein P anticorps (N-Term)

N° du produit ABIN631287

Détail du produit anti-Selenoprotein P anticorps

Antigène: Selenoprotein P (SEPP1)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Selenoprotein P est non-conjugé

Application: Western Blotting (WB)

Specificité: SEPP1 antibody was raised against the N terminal of SEPP1

Purification: Affinity purified

Immunogène: SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SEPP1 Blocking Peptide, catalog no. 33R-4984, is also available for use as a blocking control in assays to test for specificity of this SEPP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEPP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Selenoprotein P

Antigène: Selenoprotein P (SEPP1)

Autre désignation: SEPP1 (SEPP1 Produits)

Synonymes: anticorps SELP, anticorps SeP, anticorps AU018766, anticorps D15Ucla1, anticorps Se-P, anticorps selp, anticorps sepp1, anticorps MGC88974, anticorps SEPP1, anticorps SEP, anticorps DKFZp459B039, anticorps SePPb, anticorps SelPb, anticorps cb689, anticorps fb59b06, anticorps id:ibd5022, anticorps sePb, anticorps wu:fb59b06, anticorps SePPa, anticorps SelPa, anticorps cb688, anticorps wu:fa55a04, anticorps wu:fb38a09, anticorps wu:fj79f04, anticorps selenoprotein P, anticorps selenoprotein P1, anticorps selenoprotein P2-like, anticorps selenoprotein P2, anticorps SELENOP, anticorps Selenop, anticorps SELENOP1, anticorps selenop2l, anticorps SeP, anticorps selenop2, anticorps selenop

Sujet: SEPP1 is a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space.

Poids moléculaire: 46 kDa (MW of target protein)