PRKRIP1 anticorps
-
- Antigène Voir toutes PRKRIP1 Anticorps
- PRKRIP1 (Prkr Interacting Protein 1 (IL11 Inducible) (PRKRIP1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRKRIP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PRKRIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE
- Top Product
- Discover our top product PRKRIP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRKRIP1 Blocking Peptide, catalog no. 33R-5756, is also available for use as a blocking control in assays to test for specificity of this PRKRIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRKRIP1 (Prkr Interacting Protein 1 (IL11 Inducible) (PRKRIP1))
- Autre désignation
- PRKRIP1 (PRKRIP1 Produits)
- Synonymes
- anticorps C114, anticorps KRBOX3, anticorps 8430424D23Rik, anticorps PRKR interacting protein 1, anticorps Prkr interacting protein 1 (IL11 inducible), anticorps PRKR interacting protein 1 (IL11 inducible), anticorps PRKR interacting protein 1) L homeolog, anticorps PRKRIP1, anticorps Prkrip1, anticorps prkrip1, anticorps prkrip1.L
- Sujet
- PRKRIP1 binds double-stranded RNA. It inhibits EIF2AK2 kinase activity.
- Poids moléculaire
- 21 kDa (MW of target protein)
-