PRTFDC1 anticorps (N-Term)

N° du produit ABIN631292

Détail du produit anti-PRTFDC1 anticorps

Antigène: PRTFDC1 (phosphoribosyl Transferase Domain Containing 1 (PRTFDC1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRTFDC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRTFDC1 antibody was raised against the N terminal of PRTFDC1

Purification: Affinity purified

Immunogène: PRTFDC1 antibody was raised using the N terminal of PRTFDC1 corresponding to a region with amino acids AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRTFDC1 Blocking Peptide, catalog no. 33R-1226, is also available for use as a blocking control in assays to test for specificity of this PRTFDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRTFDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRTFDC1

Antigène: PRTFDC1 (phosphoribosyl Transferase Domain Containing 1 (PRTFDC1))

Autre désignation: PRTFDC1 (PRTFDC1 Produits)

Synonymes: anticorps HHGP, anticorps HPRT, anticorps hprt1, anticorps hprt1l, anticorps zgc:55561, anticorps zgc:86771, anticorps MGC80959, anticorps OTTMUSG00000011667, anticorps Prtfdc1, anticorps phosphoribosyl transferase domain containing 1, anticorps phosphoribosyl transferase domain containing 1 L homeolog, anticorps phosphoribosyltransferase domain containing 1 pseudogene, anticorps PRTFDC1, anticorps prtfdc1, anticorps Prtfdc1, anticorps prtfdc1.L, anticorps Gm13377

Sujet: PRTFDC1 belongs to the purine/pyrimidine phosphoribosyltransferase family. Epigenetic silencing of PRTFDC1 by hypermethylation of the CpG islands leads to a loss of PRTFDC1 function, which might be involved in squamous cell oral carcinogenesis.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process