INMT anticorps (N-Term)

N° du produit ABIN631293

Détail du produit anti-INMT anticorps

Antigène: INMT (Indolethylamine N-Methyltransferase (INMT))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp INMT est non-conjugé

Application: Western Blotting (WB)

Specificité: INMT antibody was raised against the N terminal of INMT

Purification: Affinity purified

Immunogène: INMT antibody was raised using the N terminal of INMT corresponding to a region with amino acids KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

INMT Blocking Peptide, catalog no. 33R-4392, is also available for use as a blocking control in assays to test for specificity of this INMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur INMT

Antigène: INMT (Indolethylamine N-Methyltransferase (INMT))

Autre désignation: INMT (INMT Produits)

Synonymes: anticorps TEMT, anticorps Temt, anticorps MGC68598, anticorps INMT, anticorps nnmt, anticorps indolethylamine N-methyltransferase, anticorps indolethylamine N-methyltransferase L homeolog, anticorps nicotinamide N-methyltransferase, anticorps INMT, anticorps Inmt, anticorps inmt.L, anticorps LOC489397, anticorps inmt

Sujet: N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine.

Poids moléculaire: 29 kDa (MW of target protein)