LCMT2 anticorps (C-Term)

N° du produit ABIN631299

Détail du produit anti-LCMT2 anticorps

Antigène: LCMT2 (Leucine Carboxyl Methyltransferase 2 (LCMT2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LCMT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: LCMT2 antibody was raised against the C terminal of LCMT2

Purification: Affinity purified

Immunogène: LCMT2 antibody was raised using the C terminal of LCMT2 corresponding to a region with amino acids PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LCMT2 Blocking Peptide, catalog no. 33R-7414, is also available for use as a blocking control in assays to test for specificity of this LCMT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LCMT2

Antigène: LCMT2 (Leucine Carboxyl Methyltransferase 2 (LCMT2))

Autre désignation: LCMT2 (LCMT2 Produits)

Sujet: LCMT2 belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW).

Poids moléculaire: 75 kDa (MW of target protein)