LCMT2 anticorps (C-Term)
-
- Antigène Voir toutes LCMT2 Anticorps
- LCMT2 (Leucine Carboxyl Methyltransferase 2 (LCMT2))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LCMT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LCMT2 antibody was raised against the C terminal of LCMT2
- Purification
- Affinity purified
- Immunogène
- LCMT2 antibody was raised using the C terminal of LCMT2 corresponding to a region with amino acids PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS
- Top Product
- Discover our top product LCMT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LCMT2 Blocking Peptide, catalog no. 33R-7414, is also available for use as a blocking control in assays to test for specificity of this LCMT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCMT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LCMT2 (Leucine Carboxyl Methyltransferase 2 (LCMT2))
- Autre désignation
- LCMT2 (LCMT2 Produits)
- Synonymes
- anticorps si:ch211-194d6.3, anticorps wu:fi38a08, anticorps PPM2, anticorps TYW4, anticorps D330024M17, anticorps Tyw4, anticorps leucine carboxyl methyltransferase 2, anticorps hypothetical protein, anticorps tRNA methyltransferase, anticorps ANI_1_1244164, anticorps AOR_1_496094, anticorps PTRG_08920, anticorps BDBG_01006, anticorps MCYG_03718, anticorps MGYG_03321, anticorps PGTG_17062, anticorps lcmt2, anticorps CAALFM_C101150CA, anticorps LCMT2, anticorps Lcmt2
- Sujet
- LCMT2 belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW).
- Poids moléculaire
- 75 kDa (MW of target protein)
-