Nitrilase 1 anticorps (N-Term)
-
- Antigène Voir toutes Nitrilase 1 (NIT1) Anticorps
- Nitrilase 1 (NIT1)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Nitrilase 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NIT1 antibody was raised against the N terminal of NIT1
- Purification
- Affinity purified
- Immunogène
- NIT1 antibody was raised using the N terminal of NIT1 corresponding to a region with amino acids VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC
- Top Product
- Discover our top product NIT1 Anticorps primaire
-
anti-Nitrilase 1 (NIT1) (AA 228-327) antibody
NIT1 Reactivité: Humain WB, ELISA, IF, IP Hôte: Souris Monoclonal 1C3 unconjugated
anti-Nitrilase 1 (NIT1) (AA 1-243) antibodyNIT1 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Nitrilase 1 (NIT1) (AA 298-327), (C-Term) antibodyNIT1 Reactivité: Humain WB Hôte: Lapin Polyclonal RB32905 unconjugated
anti-Nitrilase 1 (NIT1) (AA 1-150) antibodyNIT1 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Nitrilase 1 (NIT1) (AA 71-120) antibodyNIT1 Reactivité: Humain, Chien, Cobaye, Cheval, Porc, Roussette (Chauve-souris), Singe WB Hôte: Lapin Polyclonal unconjugated
anti-Nitrilase 1 (NIT1) (AA 71-120) antibodyNIT1 Reactivité: Humain, Chien, Cobaye, Boeuf (Vache), Lapin WB Hôte: Lapin Polyclonal unconjugated
anti-Nitrilase 1 (NIT1) (N-Term) antibodyNIT1 Reactivité: Humain, Rat, Chien, Cobaye, Boeuf (Vache), Lapin, Cheval, Porc WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NIT1 Blocking Peptide, catalog no. 33R-9769, is also available for use as a blocking control in assays to test for specificity of this NIT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Nitrilase 1 (NIT1)
- Autre désignation
- NIT1 (NIT1 Produits)
- Synonymes
- anticorps MGC85476, anticorps zgc:101630, anticorps ZmNIT1, anticorps DDBDRAFT_0217173, anticorps DDBDRAFT_0302491, anticorps DDB_0217173, anticorps DDB_0302491, anticorps AI255805, anticorps ESTM30, anticorps W57327, anticorps A. THALIANA NITRILASE 1, anticorps ATNIT1, anticorps NITI, anticorps NITRILE AMINOHYDROLASE, anticorps nitrilase 1, anticorps nitrilase 1 S homeolog, anticorps nitrilase 1, anticorps nit1.S, anticorps nit1, anticorps NIT1, anticorps nit1-2, anticorps Nit1
- Sujet
- NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells.
- Poids moléculaire
- 36 kDa (MW of target protein)
-
