RUFY1 anticorps (C-Term)

N° du produit ABIN631310

Détail du produit anti-RUFY1 anticorps

Antigène: RUFY1 (RUN and FYVE Domain Containing 1 (RUFY1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RUFY1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RUFY1 antibody was raised against the C terminal of RUFY1

Purification: Affinity purified

Immunogène: RUFY1 antibody was raised using the C terminal of RUFY1 corresponding to a region with amino acids QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RUFY1 Blocking Peptide, catalog no. 33R-7487, is also available for use as a blocking control in assays to test for specificity of this RUFY1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUFY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RUFY1

Antigène: RUFY1 (RUN and FYVE Domain Containing 1 (RUFY1))

Autre désignation: RUFY1 (RUFY1 Produits)

Synonymes: anticorps RABIP4, anticorps ZFYVE12, anticorps 3000002E04Rik, anticorps Rabip4, anticorps rabip4, anticorps zfyve12, anticorps RUN and FYVE domain containing 1, anticorps RUN and FYVE domain containing 1 L homeolog, anticorps RUFY1, anticorps Rufy1, anticorps rufy1, anticorps rufy1.L

Sujet: RUFY1 contains 1 FYVE-type zinc finger and 1 RUN domain. It binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in early endosomal trafficking.

Poids moléculaire: 69 kDa (MW of target protein)