RNF165 anticorps (Middle Region)

N° du produit ABIN631316

Détail du produit anti-RNF165 anticorps

Antigène: RNF165 (Ring Finger Protein 165 (RNF165))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF165 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RNF165 antibody was raised against the middle region of RNF165

Purification: Affinity purified

Immunogène: RNF165 antibody was raised using the middle region of RNF165 corresponding to a region with amino acids SSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLG

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF165 Blocking Peptide, catalog no. 33R-8857, is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF165

Antigène: RNF165 (Ring Finger Protein 165 (RNF165))

Autre désignation: RNF165 (RNF165 Produits)

Synonymes: anticorps RNF165, anticorps ARKL2, anticorps 2900024M11Rik, anticorps AI427432, anticorps G630064H08Rik, anticorps Gm96, anticorps RGD1560744, anticorps si:ch73-29c22.3, anticorps ring finger protein 165, anticorps ring finger protein 165a, anticorps RNF165, anticorps Rnf165, anticorps rnf165a

Sujet: RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.

Poids moléculaire: 38 kDa (MW of target protein)