SPDYA anticorps
-
- Antigène Voir toutes SPDYA Anticorps
- SPDYA (Speedy Homolog A (SPDYA))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SPDYA est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SPDYA antibody was raised using a synthetic peptide corresponding to a region with amino acids HTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK
- Top Product
- Discover our top product SPDYA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SPDYA Blocking Peptide, catalog no. 33R-3860, is also available for use as a blocking control in assays to test for specificity of this SPDYA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPDYA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SPDYA (Speedy Homolog A (SPDYA))
- Autre désignation
- SPDYA (SPDYA Produits)
- Synonymes
- anticorps zgc:101624, anticorps 4921517J08Rik, anticorps 4930548B21Rik, anticorps GS4, anticorps MLZ-465, anticorps Spdy1, anticorps RINGO, anticorps SPDY1, anticorps RINGO3, anticorps RINGOA, anticorps SPY1, anticorps Gs4, anticorps Lm23, anticorps Spy1, anticorps speedy homolog A (Xenopus laevis), anticorps speedy/RINGO cell cycle regulator family member A, anticorps speedy/RINGO cell cycle regulator family, member A, anticorps SPDYA, anticorps spdya, anticorps Spdya
- Sujet
- SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.
- Poids moléculaire
- 36 kDa (MW of target protein)
-