TRIM55 anticorps (N-Term)

N° du produit ABIN631327

Détail du produit anti-TRIM55 anticorps

Antigène: TRIM55 (Tripartite Motif Containing 55 (TRIM55))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM55 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIM55 antibody was raised against the N terminal of TRIM55

Purification: Affinity purified

Immunogène: TRIM55 antibody was raised using the N terminal of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM55 Blocking Peptide, catalog no. 33R-8464, is also available for use as a blocking control in assays to test for specificity of this TRIM55 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM55

Antigène: TRIM55 (Tripartite Motif Containing 55 (TRIM55))

Autre désignation: TRIM55 (TRIM55 Produits)

Synonymes: anticorps MURF-2, anticorps RNF29, anticorps muRF2, anticorps trim55, anticorps wu:fb71c01, anticorps zgc:92123, anticorps TRIM55, anticorps im:7145460, anticorps zgc:136833, anticorps D830041C10Rik, anticorps Murf2, anticorps Rnf29, anticorps murf-2, anticorps rnf29, anticorps tripartite motif containing 55, anticorps tripartite motif containing 55a, anticorps tripartite motif containing 55b, anticorps tripartite motif-containing 55, anticorps tripartite motif containing 55 L homeolog, anticorps TRIM55, anticorps trim55a, anticorps trim55b, anticorps Trim55, anticorps trim55.L

Sujet: TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.

Poids moléculaire: 60 kDa (MW of target protein)