LIPT1 anticorps (N-Term)
-
- Antigène Voir toutes LIPT1 Anticorps
- LIPT1 (Lipoyltransferase 1 (LIPT1))
- Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LIPT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LIPT1 antibody was raised against the N terminal of LIPT1
- Purification
- Affinity purified
- Immunogène
- LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE
- Top Product
- Discover our top product LIPT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LIPT1 Blocking Peptide, catalog no. 33R-6654, is also available for use as a blocking control in assays to test for specificity of this LIPT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LIPT1 (Lipoyltransferase 1 (LIPT1))
- Autre désignation
- LIPT1 (LIPT1 Produits)
- Synonymes
- anticorps EG623661, anticorps lipoyltransferase 1, anticorps chromosome 10 C2orf15 homolog, anticorps LIPT1, anticorps MCYG_01144, anticorps MGYG_01698, anticorps C10H2orf15, anticorps Lipt1
- Sujet
- The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, LIPT1 transfers the lipoyl moiety to apoproteins.
- Poids moléculaire
- 42 kDa (MW of target protein)
-