TRIM49 anticorps (Middle Region)
-
- Antigène Voir toutes TRIM49 Anticorps
- TRIM49 (Tripartite Motif Containing 49 (TRIM49))
-
Épitope
- Middle Region
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRIM49 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRIM49 antibody was raised against the middle region of TRIM49
- Purification
- Affinity purified
- Immunogène
- TRIM49 antibody was raised using the middle region of TRIM49 corresponding to a region with amino acids VHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTF
- Top Product
- Discover our top product TRIM49 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRIM49 Blocking Peptide, catalog no. 33R-9578, is also available for use as a blocking control in assays to test for specificity of this TRIM49 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM49 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRIM49 (Tripartite Motif Containing 49 (TRIM49))
- Autre désignation
- TRIM49 (TRIM49 Produits)
- Synonymes
- anticorps RNF18, anticorps TRIM49A, anticorps TRIM49L2, anticorps tripartite motif containing 49, anticorps TRIM49
- Sujet
- TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis.
- Poids moléculaire
- 53 kDa (MW of target protein)
-