RNF160 anticorps (N-Term)
-
- Antigène Voir toutes RNF160 (ZNF294) Anticorps
- RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF160 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ZNF294 antibody was raised against the N terminal of ZNF294
- Purification
- Affinity purified
- Immunogène
- ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA
- Top Product
- Discover our top product ZNF294 Anticorps primaire
-
anti-Zinc Finger Protein 294 (ZNF294) (N-Term) antibody
ZNF294 Reactivité: Humain, Souris, Cheval, Lapin, Rat, Boeuf (Vache), Chien, Porc, Poisson zèbre (Danio rerio) WB Hôte: Lapin Polyclonal unconjugated
anti-Zinc Finger Protein 294 (ZNF294) (AA 462-591) antibodyZNF294 Reactivité: Humain ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Zinc Finger Protein 294 (ZNF294) (AA 47-96) antibodyZNF294 Reactivité: Humain, Souris, Cheval, Lapin, Rat, Roussette (Chauve-souris), Singe WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZNF294 Blocking Peptide, catalog no. 33R-6032, is also available for use as a blocking control in assays to test for specificity of this ZNF294 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF294 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))
- Autre désignation
- ZNF294 (ZNF294 Produits)
- Synonymes
- anticorps C21orf10, anticorps C21orf98, anticorps RNF160, anticorps ZNF294, anticorps Zfp-294, anticorps 4930528H02Rik, anticorps AV266914, anticorps C87237, anticorps Listerin, anticorps Rnf160, anticorps Zfp294, anticorps Znf294, anticorps listerin E3 ubiquitin protein ligase 1, anticorps LTN1, anticorps Ltn1
- Sujet
- ZNF294 may function as an E3 ubiquitin-protein ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
- Poids moléculaire
- 200 kDa (MW of target protein)
-
