HERC6 anticorps (N-Term)
-
- Antigène Voir toutes HERC6 Anticorps
- HERC6 (HECT and RLD Domain Containing E3 Ubiquitin Protein Ligase Family Member 6 (HERC6))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HERC6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HERC6 antibody was raised against the N terminal of HERC6
- Purification
- Affinity purified
- Immunogène
- HERC6 antibody was raised using the N terminal of HERC6 corresponding to a region with amino acids LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH
- Top Product
- Discover our top product HERC6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HERC6 Blocking Peptide, catalog no. 33R-5433, is also available for use as a blocking control in assays to test for specificity of this HERC6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HERC6 (HECT and RLD Domain Containing E3 Ubiquitin Protein Ligase Family Member 6 (HERC6))
- Autre désignation
- HERC6 (HERC6 Produits)
- Synonymes
- anticorps 1700121D12Rik, anticorps 2510038N07Rik, anticorps 4930427L17Rik, anticorps AI451296, anticorps CEB1, anticorps Herc5, anticorps HECT and RLD domain containing E3 ubiquitin protein ligase family member 6, anticorps hect domain and RLD 6, anticorps HERC6, anticorps Herc6
- Sujet
- HERC6 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins.
- Poids moléculaire
- 115 kDa (MW of target protein)
-